Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G360023-GRMZM2G444567
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100275522
Function (paralog2):hypothetical protein LOC100275454

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.7338362770194
Log2 mRNA fold difference:-1.6348388098964
Log2 TE fold difference:-0.84026349305077
Sequences
Protein sequence

MHMKPEKRKRGRRAAAAAAAASAAHSLGHWGRSSHQQSPLTMQRHSPLASPRRASAEPKP
GADRRPHPHSTTTKGRTPKRLGAPPLPVPVSHRPTKHTQLCPEAENRQPDMKRTRAQQPK
VEEPQDLAANLKPQRRDKQPRQPKSGAKAKPAAGPRVAAATTLAAAAAAAAAAANAASAA
SSPGPETAPTVPDVCVGGDKDGDADADASAVDWDLDAGLSAAAWWTWGVDEEKLLGWFPF
VEEDFRCAGGGAAEVAAFDHDIWSIW*

MKRTRAQQSKAEEPQDPSAAAAANPNPNPKPQQRRAKQPRQPKAGARARPAAANAAPSSP
GPETAPAVPDARAVDCWDLDAGLSAAAAWWTWGVDEDKLLGWFPFVEEDFRCAGAGARSC
EAEAEAAAFDHDIWSIW*

Other information
Ka divergence:0.384188KaKs divergence:0.498221
GC content 1 (%):70GC content 2 (%):74GC content divergence:0.028
Length 1 (bp):801Length 2 (bp):414Length divergence:-0.319
MFE 1 (kcal):-362.68MFE 2 (kcal):-224MFE divergence-0.236