Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G361993-GRMZM2G466229
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383036 (LOC100383036), mRNA
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:2.4355107023273
Log2 mRNA fold difference:0.18452311293204
Log2 TE fold difference:2.5619789064005
Sequences
Protein sequence

MGVHLLKKQHSSAPSSLGRGSGSGSASGSSVSASSMPPKGCMAVRVVGPSSAAAGRKEQE
QEEEEERFVVPVGYLKHPLFVALLQAAEEEYGFEQKGAITIPCGVDHFRRVQGIIHHHGS
GGGHHHGHHSSSSSNHFHIAGCFRA*

MGVHRLKKQHSSAPSLGGGSGSSMPPKGCMAVRVVGPAGGGHKEEEEEEERFVVPVGYLT
HPLFVALLKAAEEEYGFEQKGAITIPCGVDHFRRVQGIIHHHRVSGGGGGGGGGGHHNSN
HFHIAGCFRA*

Other information
Ka divergence:0.0189569KaKs divergence:-0.608616
GC content 1 (%):71GC content 2 (%):70GC content divergence:-0.007
Length 1 (bp):438Length 2 (bp):393Length divergence:-0.054
MFE 1 (kcal):-221.41MFE 2 (kcal):-197.36MFE divergence-0.057