Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G363535-GRMZM2G365983
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383188 (LOC100383188), mRNA
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.0882850496217
Log2 mRNA fold difference:-0.48356718668425
Log2 TE fold difference:1.5970719425008
Sequences
Protein sequence

MEPSGSDKPTATDANESVVGLDGEDTLSERESVGAKDGPALPNGSGKEAHASSPSAANKR
KHNDLGSNQMELNEPGTPSSSSGDSTWSINGLDDCHQLSLSRNKNDDSEHSVTSAGVTVI
RQPRGVLRLRKLAQNVSTESWTGGHNTSQANGVPRSSQHPRRNNKRESIPSQENRVSGDE
PVSCLRTENGTCDQDTGTKFCSKTEFLAEKQSHLSGEPPKAVHVDKGVYDYVKDDDGDSL
EENAAWMLCSLSDNKCAGSPRKGTDRLSKRSFSQNSNHFKNSYEKIKDICSPARLLRKRD
GKVPFLKRRQRRHFYEVSPSDVDPFCIVKERIRVFWPLDETWYFGMVKEYNPVTRLHHVR
YDGKDEEWINLQNERIKLLFLPAEAPNKSKCTNSRSAFESKHEQGDREDMHRSGSNTESF
ESGPISSWLARSNQAKSAALCDINKQDHSHSNTVPVSFDQKQCRASDAKESIDSAPCSSL
ANGGVEVLKDRTIPEDGRFHFVYSRKRFCRKKNDFLSISEQHSNCQRRASSMVLASCPDM
KSSIATGASVTYVIPALSLPLKPVYKLLCEACCVSVSNAFFLLQCGTMVALWPVVHLDIL
LIDSALGLKRFLLDTCMRSAVSLFCLLAGSFKQCSRQRTTKESRIPCTSVRFQISGGHGR
SQVVFMFFSFVGVEKWKWEHLQGKLQYQCSKRELSKDSTKCTGRRALPSMGLFSKGFDVQ
ESVFLPESNYSDIKPAICCLDDRCKFTQSFLDMTTAPSVLLWHHRKMLMESNSTNGSQQS
MSCALDEDHQQLFRDQNEPCIGADRPCSSNLSVICSSQKFAEDRISINIPQDKAIDATND
KPLDKDEKEKHPISNLVQELNEHPIGRVTPTAPRTTSHRNRFTSISRAFGDGSKLLPEDH
MLTGFASGSKKPRSQVSYSGSPRSEELGLKNKDHFRKIQSHVSVKTSDAKKLPDSSRSGH
SSPELLTCIANVLVTVGDRGWREYDTQITMDSDVHSEQRICVKLAEGTKYAHKVCQVLQP
GATNRYTHAMMWKGGAEWCLEFPDRSQWLIFKQMHDECYSHNIRAASVRNIPTPGVHLVG
IHDDNDMVSFVRSEDYLVHIGTDVEIALDEARVLYNMDSDDEEWISSRQKFLVRDNNATL
ELAEDLFERVMDKLEKFAYSHDSNELSIVQMKELETDDLPLDIIEVIHAYWQAKRQKKGM
PLIRHFQFAMWKVYEQQLHEWESKVCRMQGSSNGYQGKKMPPKPALFAFCLRPRGLDVPY
KGPKQRSHKKLMSTGCHSFSRQHDGFYRQVSGRRYNECTVDGRICELYDIGSLYSLTGYS
PRFSTRTGSLRAFESSESSTPRFFRTNIVKRSATVAFSDDHQPSPSFRPQRVKRSASDHW
NTVIHDWQNSKHLFPGSPPVDIEELKLRDAASAAQHAAAMAKLKREKAHCLMQKADLALH
KATVALMIADAIKSSSRNKSRDCRRGFDE*

MESSGGDKPTATDATESVVGLDGEETLSERESVGARHGPALSNGGGKEAPSSSSSAGNKR
KHGILGSNQMELNEPGMPSSSSGDSTWSLDSLDDRHQISLLRSKNEHSEHSVTSAGVTVI
RQPRGVLRLRKRDQNVSTESWTGGHNIPQANGVPRSSQLLRRNKKGKSTVFEQNRIGGDE
PVSCLRTENGTCDQDTGSKFCSETEFSAEKLSHLSGEAPKAVHVDKGGCDHVKDDDGVSL
EENAAMMLCSLSDNICAGSPRKGMKSSDTSSKRCIPQHSNHFKSSNKKIKDVPSPARLLR
KRDGKVPFRKRRPRRHFYEVSPSDVDPFCIVKERIRVFWPLDETWYFGLVKEYNPDTRLH
HVRYDDKDEEWINLQNERIKLLFLPAEARNRSKCTNSRSVFDLKHEQGDREDMDGSEGNT
ESSESGPIGSWLARSNQAKSAALCNISKQDHSHSNIVPISFDQKQCRGSDAKESNDYIPC
DSFGNGSAKVLKDRTTPEDRRFRFVYSRKRFCRKTNGFLSISEQHSNCQIRARFAMVLAA
CPGMESSSATGASVTYVIPALSLPLKPVYKLLCEACCVSFSNTFFLHCGTMVALWPVVHL
DILFDNALGLKHFLLDTCLISAVSLLCLLAGSFKQCSRQRTTKEARIPCTSIRFQISGGH
GRSEVVFMLFNFVGVEKSKWEHLQGKLQYHCSKSELSKDSTKCTGRRALSSMDLFSKVSS
CL

Other information
Ka divergence:-0.163748KaKs divergence:-0.184752
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):4410Length 2 (bp):2166Length divergence:-0.341
MFE 1 (kcal):-1384.36MFE 2 (kcal):-678.11MFE divergence-0.342