Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G363554-GRMZM2G457929
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100272780

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.5514705242918
Log2 mRNA fold difference:-0.70866049735745
Log2 TE fold difference:-1.1833508577491
Sequences
Protein sequence

MPAMVEEGLVRRAAPEPHFLVVTFPAQGHINPARHLARRLLRATGARVTVCTAVSALRKM
FPGAEADAEEGHRDGAGVRYVPYSDGYDDGFDGAVHDATRYMDQVKVVGSRTLGDVLARL
RGAGRPATLVVYTLLLSWVADVARAHAVPAALYWIQPATVLAVYLHFFRATGGVDAAVAA
AGGDPWAGVRFPGLPPLRVRDLPSFIVSTSEDDPYAFVADAFRELVGRLDGGEDSPSVLA
NTFDAVEPEAVASLREHGVDVVPVGPVLSFLDDDAAAGGNNDLFTQDGKGYLEWLDAQAP
GSVVYISFGSLSVMRRRQIEEVARGMSESGRPFLWVLREDNRRSEGADADAATLAGGGRG
MVVGWCDQVRVLSHPAVGCFVTHCGWNSTLESTACGVPVVCVPQWTDQGTNAWLVERIGT
GVRAAVSDKDGVLEAGELRRCIDLATSDMVRAKAAVWREKARAAASKGGSSERNLKAFVA
KQIAGGNN*

MPAMVVEEDLIRGAAPEPEPEPHLLVVTFPAQGHINPARHLARRLLRATGARVTVSTAVS
ALRKMFPGEQAGAEGHRDAAGVWYVPYSDGYDDGFDRDAHDATHYMEQIKLVGAATLGAV
LDRLHGVGRPVTLVVYTLLLSWVADVARARSVPAALYWIQPATVLAVYLHFFRATDGVDR
AIAAAGGDPWASVRFPGLPPLRVRDLPSFIVSTPENDPYAFVADAFRELVETLGREDKPS
VLANTFDAVEPEAAASLREAGVDVVPVGPVVSFLDDAAAGAGGAKNGGNNNDLFKQDGEG
YLDWLDAQAPGSVVYISFGSLSVMSKRQIEEVARGMAESGRPFLWVLREDNRSSEGAGAG
AAPLADWEGERGMVVGWCDQVRVLSHPAVGCFVTHCGWNSTLESMACGVPVVCVPQWTDQ
GTNAWLVERIGTGVRAAVSDKDGVLEADELRRCLDFATSEMVRAKAAVWREKARAAASEG
GSSEMNLRAFVAKQIAGGKN*

Other information
Ka divergence:-0.0722349KaKs divergence:0.115009
GC content 1 (%):73GC content 2 (%):73GC content divergence:0
Length 1 (bp):1467Length 2 (bp):1503Length divergence:0.012
MFE 1 (kcal):-834.1MFE 2 (kcal):-859.2MFE divergence0.015