Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G365162-GRMZM2G442000
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100279643 (LOC100279643), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.05372957587225
Log2 mRNA fold difference:0.7265813408663
Log2 TE fold difference:-0.81815394222521
Sequences
Protein sequence

MAKCSSKIRYIVWLRQTLRRWRSRAAARAAVPAGHVAVCVGGAARRFVVRAAHLNHPVFR
ELLRQAEEEYGFPSGACAGPIALPCDEGLFEHVLRHLSSPSKSARFVTLEDLESGALSCC
CVAAAGDSLPLLRGISADKAVW*

MEKCSSKIRSIVWLRQTLRRWRSRAASRAAAAAAADAAVPSGHVAVCVGGASRRFVVRAA
HLNHPVFRELLRQAEEEYGFPRAGPIALPCDEALFEHVLRHLSAPSKSSSRFVTLDDLQS
AGATHCCCVAAAGDSLPLLRGFSADKAVW*

Other information
Ka divergence:0.6829KaKs divergence:0.940622
GC content 1 (%):74GC content 2 (%):74GC content divergence:0
Length 1 (bp):429Length 2 (bp):450Length divergence:0.024
MFE 1 (kcal):-238.2MFE 2 (kcal):-248.4MFE divergence0.021