Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G370715-GRMZM2G375222
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.1311093754427
Log2 mRNA fold difference:0.60476690434059
Log2 TE fold difference:-0.48400337507655
Sequences
Protein sequence

MEMIGSGSRSCLCHSSFLPGFFTGGEHAEKLSHKRTERSHPLPFLVKEEELSGDELEEFI
KNRYSNRVKYAADRSYSREDDDIFPMDCALKEPTIWRVKCMVGRERQMAFCFMQKFVDLR
KIGTKVPIITAFALDHIRGFVFVEAEKAGYVTEACKGFCSVYTSRITSVPATEVPSLLSS
RTKPFEISRGTWIRMKNGNYKGDLAQGGAVSLKEAAVPAPRFFRPHIEIKRDRQTGEVFE
VLDGLMFKDGFLYKKVALSSLIYWGIQPTETELLKFSSSPSNRASADDLDWLSGMYGSKK
RNLPAERDMKSSSSKIKSSKAPDLKGSTSTENYDDNDEFNLHDLVLYGRKDFGVIIAVEK
DGFRILKGGPEGSAVTVRKQDIKKGCVDKMFTAVDHHKKTISINDTVNVVEGPFQGKQGL
VKHLYLGILFIFNESESENCGFFCAQSGSCEKIRKGLGSSTTENSDFPTPMFSEPAYEQN
EHRNTEGPYRSTREQLFSIGQMLRIRKGPLKGYLCRVVRIFRNDVTVKLDSLLKIVTVQA
DLLSVPANRGDNLSGAPASKFGSQDTPFFGSEAGKTSWDRGLPSFGSDSWQPFSSSTLPV
QNAGAESEADPWCKKTSAEDDSDPWGKKTDGDSDPWGKEAVSAADGDCNPWGKETVPSAA
GDSDPWGKKVFSADGDSDPWGKKAISSAVEVWNTSATQKEGSSGNAWDKQAGVGGSDAAG
SSWDRAVVNKESEKSDNWGEACRVMDMGTGADTDPWGSKVKAVDMEGPNSWEKATMPPDN
KLEDVSQGWNQHKGNSTEDQAKDNVSKDEDNNRAWSSSLPVTEDGTWGKSKDDNCDGAGG
AGGWDASVANWNKSSVLADAQDEGWGKGNWSSAKSEETNNEIGNWNKAGASDQAGPKSFG
GDGWNKGGDQNSSWNSPGNFGGGRGFGRGRGRVRGRESGDFNGRNDQGNWKNSWGGDNAE
KSSWRSDNQVDNEAGDSGGYRGRGRGGRGQYGGRGRGRDNGWRNGDGPKWGGGDNWNATN
PPSNQPWSSSGGTKSYGQNQPSTWNNPEDNKPSVGEQGDPWASKVSSTEGKGQQNDSWSS
KMTSRGAEDTSGGWDSKEKGSSCNGGGEGLQNDPWANKIGSNEGKEQEADPWASKMSSAV
GADDKNGTWDTTTKGTLSNEKADDPWNSKRGNDDDSKKTDAWGAGSSGGNQESSWSKPIF
SLGDQEPTWNNPRFGDDDNVNNRGGFGRGNQGRGRGRSFGGGGGGSSWNESNKNGESGGG
RSGEPWNRRGFDGGRGRGRFGRGDRNQGNNLGSGDGGSWGSGRGNGGGRGGYRNWNDNNE
RRPFGQGGGWSQSSDWNANKGSGEGNQAFSKSKPSWDAQNASGGDDQAGKKSDTDNSWSQ
NRSSPSILGQPSGDANNKSSAWDGAPNGGAGRGGSGSWGKSDEDGWNSSSGGSAREKPSW
GGGAEAPPRKEDDGAWGKGGEGSRSLGGGGEGGSSSSWDKPADGAWSGNNKGGSGSGGW*

MAVKGKGKQVAAESPGPGAGAGGASGSGGKRRMASSDAGAGPSSSSAAKRRRRAGVLQFV
DDVAGVDDDYEEDELESEDDTDDGFFTGGEHAQNLSHKRTERSHPLPFLVKEEELSGDEL
EEFIKNRYSNRVKYAADRSYSREDDDIFSMDCALKEPTIWRVKCMVGRERQMAFCFMQKF
VDLRKIGTKVPIITAFALDHIRGFVFVEAEKACDVTEACKGFCSVYTSRITSVPAAEVPS
LLSSRTKPFEISRGTWIRMKNGNYKGDLAQGGAVSLKGAAVPAPRLISSQELEFFRPHIE
IKRDRQTGEVFEVLDGLMFKDGFLYKKVALSSLIYWGIQPTETELLKFSSSPSNRASADD
LDWLSGMYGSKKRNLPEKRDMESSSSKIRSSKASDLKASTSTENYDENDEFNLHDLVLYG
RKDFGVIVAVEKDGFRILKGGPEGSAVKVRKQDIKKGCVDKMFTAVDHQKKTISINDTVN
VVEGPFQGKQGVVKHLYLGILFIYNESESENCGFFCAQSGSCEKIRKGLGSSTTESSDFT
TPMFPEPAYEQNGHRDTERPYRSTREQLFSIGQMLRIRKGPLKGYLCRVVRIFRNDVTVK
LDSLLKIVTVQADLLSVPANRGDNLSGAPASKFGSQDTSFFGSEAGKTSWDNGLPSFGSD
SWQPFSSSTLSVQNAGGESEADPWSKKTSAKDDSDPWGKKTDGDSDRWGKKTDGDSDPWG
KEAVSAADGDSNPWGKETVPSAAGDSDPWGKKVVSSADGDSDSWGKKATSSAVDTEKEGS
GGTAWDKQAGVGGSDAAGSSWDRAVVNESEKSDNWGEACRVMDMGTGAEADTDPWGSKVK
AVDMEGPNNWEKATVPPNNKLEDVSQGWGQPKGNSTEDQAIDNVSKDVDNNRACDSSLPV
TEDGTWGKSKDNSCGGAGGAGGWDVSVGNWNKSSVVADAQDEGWGKGNWSSAESEETNNQ
SGNWNKTGASDQAGYNNWDKPKSFGGNGWNKGDDQNSSWNRPENFGGGRGFGRGQGRGRG
QQSGYFNGRNDQGSWKKSWGSDNAERPSWRSDNQVDNEAGESGGYRGRGRGGRGQYGGRG
KDNGWRNDDRSNSGFGRENNSGDGPKWGGGGNWNATNPPSSSVGTKSYGQNQPFTWNNSE
DNKPSVGEQGDPWASKVSSTEDTEQQNDSWSSKMISGGAEDTSGGWDTKVKDSSCNDGGE
GLQNDPWANKIGSNEGKEQETDPWASKMSSTVCADDKKGSWNTTAKGIPSKEKADDPWNS
KGGNDDSKKTDTWGAGSSGGDQELSWSKPNFSLGDQESTWNNPRFSDDDNANNRGGFGRG
NRGRGRGRNFGDGGGSSWNGGNRNDESGGGRSGEPWNRRDFDGGGGRGRGRFGRGDRNQG
NNFGSGDGGSWGSGRGNGGRGGYRNWNDNNERSFGEGGGWSQSQSSDWNANKGNGEGNQA
FSKSKPSWEAQNTSGRDGQAGKGDANNSWSKNRSSPSSAWGAPSGGAGGRGSWGKSNEDG
WNSAGGSAKEKPAWGGGSEASTKKEDKGGEGNGSQGGGGVSSWDKGADDAWNGNTGSDIG
SGGW*

Other information
Ka divergence:-0.262128KaKs divergence:-0.297868
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):4500Length 2 (bp):4695Length divergence:0.021
MFE 1 (kcal):-1546.88MFE 2 (kcal):-1570.63MFE divergence0.008