Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G379179-GRMZM5G850092
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279405
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.965309796984
Log2 mRNA fold difference:0.9622738338992
Log2 TE fold difference:0.010807769612296
Sequences
Protein sequence

MAEEPPPPPLARKSAPAQPWSHVETTHLIDAYEERWTALRRGQLKAHQWEEVAAEVAARC
AATPGVVAQRKTGTQCRHKLEKLRKRYRTEGARPVTSLWPYFRRMDRLERGPLAVASSAY
PAATGSPPAADGDEEGEEEEEEVEEEEEEEDVQEENEEEEELAPRNNNTRSINGIIREFG
TGLAPRHPQLQLHPPPPSITPSIAPPRKRVAYEAFQAKAAAAAVKAKDDEEEAMEMARRR
GSSGRPVAQLSAVLRDFGEGVMRLERRRMEVQWEIERGWQEADARHARMLQDAQRQLRDT
VAGACALPPKKARRDHGDS*

MADEPPPPALARKSAPAQPWSHVETMHLIDAYEERWTALRRGQLKAHQWEEVATEVAARC
AANPGVIAQRKTGTQCRHKLEKLRKRYRTEGARPVTSLWPYFRRMDRLERGALAAYPAAA
SSPPAADGDEEEDEEDVQEEEEVEELVPRNNTRSINGIIREFGTGLAPRHPQLQLHPPPS
SITPSTAPPRKRVAYEAFQAKDEAVAVEMTRRGGSGWAVAQLSVVVRDFGEGVMRLERRR
MEVQWEIERGWQEADARHARMLKDALRQFRDTAAAAACVLPPKKARRDHGDS*

Other information
Ka divergence:0.384703KaKs divergence:0.507181
GC content 1 (%):70GC content 2 (%):71GC content divergence:0.007
Length 1 (bp):960Length 2 (bp):879Length divergence:-0.044
MFE 1 (kcal):-468.9MFE 2 (kcal):-428.6MFE divergence-0.045