Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G383540-GRMZM5G808811
Species:maize
Duplication type:WGD
Function (paralog1):DAG protein
Function (paralog2):hypothetical protein LOC100383758 (LOC100383758), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.031809251756198
Log2 mRNA fold difference:0.41191532745718
Log2 TE fold difference:-0.48980647643796
Sequences
Protein sequence

MAAAAARRLLSRRASSSSLSALLRRGAVPEQSLVLRPAVVAAASRLGFQRGMARRPGGDG
YVSTRSGAGGDRAPMATEMAPLFPGCDYEHWLIVMDKPGGEGASKQQMIDCYIQTLAKVL
GSEEEAKKKIYNVSCERYFGFGCEIDEETSNKLEGLPGVLFVLPDSYVDAEYKDYGAELF
VNGEIVQRTPERQRRVEPVPQRAADRPRYNDRTRYARRRENQR*

MAAAAAAARRLLSRRASSNSLSAFLRRGAAPEQSLLRPAVVAAASRLGFPRGMARRPGGD
GYGAGRDRAPTEMAPLFPGCDYEHWLIVMDKPGGEGATKQQMIDCYIQTLAKVLGSEEEA
KKKIYNVSCERYFGFGCEIDEETSNKLEGLPGVLFVLPDSYVDPEYKDYGAELLVNGEIV
QRPPERQRRVEPVPQRAADRPRYNDRTRYARRRENQR*

Other information
Ka divergence:-0.0826131KaKs divergence:0.0563626
GC content 1 (%):65GC content 2 (%):66GC content divergence:0.008
Length 1 (bp):672Length 2 (bp):654Length divergence:-0.014
MFE 1 (kcal):-308.32MFE 2 (kcal):-302.84MFE divergence-0.009