Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G391596-GRMZM2G432060
Species:maize
Duplication type:WGD
Function (paralog1):SAUR11 - auxin-responsive SAUR family member
Function (paralog2):SAUR11 - auxin-responsive SAUR family member

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.4898210336723
Log2 mRNA fold difference:-2.9037461460997
Log2 TE fold difference:0.60308227352019
Sequences
Protein sequence

MLTRRHGGFRLGRKLLSVWRWALCRRRRRRGRGYLRLQPCQRGGGTNKSPSPMAAHAVVS
IKMMQQQQQKHDVSAGSPRMLTWGRSLAQRVRLLRRRGEGGRKDRLLEDAAAEATTPKGQ
VAVYVGGGGESMRYVVPVVYFNHPLFGELLREAEEEFGFQHPGGITIPCAASRFERAAAV
AAAGGGGGAGKKVPSVWW*

MPRRRHGGFRLGWKLLGVWCWAALCRRRRRGRGYLRLHPRQQGGGSDRSPPLQAGVAAVC
ATKQKKQQQQQRDDSADSPRMLTWGRSLARRMSLLRRRAGEKGRLLDDEDAAEATTPKGQ
VAVYVGGAEPGAESMRYVVPVVYFNHPLFGELLREAEEEFGFQHPGGITIPCAASRFERA
AAVAAAGGGAGKKVPAGWW*

Other information
Ka divergence:0.214532KaKs divergence:0.040071
GC content 1 (%):72GC content 2 (%):73GC content divergence:0.007
Length 1 (bp):597Length 2 (bp):600Length divergence:0.003
MFE 1 (kcal):-344.8MFE 2 (kcal):-349.7MFE divergence0.007