Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G391746-GRMZM2G427603
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100275872

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.03633013502897
Log2 mRNA fold difference:-0.41344368732405
Log2 TE fold difference:0.35958065179416
Sequences
Protein sequence

MRRRWSRAAVLACLLLLACVAESRAVPDASGGGGGPGEQRRGAFDVVVVGLVSIGLGRRW
RAGEMVDEDKRRVPTGPNPLHNR*

MRSRRWSRAAVLAWLVLVAAAACVADESRAVPAARNRTGTGTAAVSVRQQQQQRGAFDVV
VAGLVSIGLGRRWRAGGMVDEDKRRVPTGPNPLHNR*

Other information
Ka divergence:0.478811KaKs divergence:0.256375
GC content 1 (%):75GC content 2 (%):75GC content divergence:0
Length 1 (bp):252Length 2 (bp):291Length divergence:0.072
MFE 1 (kcal):-136MFE 2 (kcal):-165.4MFE divergence0.098