Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G398055-GRMZM2G471600
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.4707817288507
Log2 mRNA fold difference:-4.6845844647078
Log2 TE fold difference:3.4100333964991
Sequences
Protein sequence

MREEEEASWFARGEEQQLLRPDELMPLTQTLITPHLAVAFDITTHGAGGTGAAGGAGAGP
GAGGPDINGGGASSAAGSSGGGGGGGGDEPARTLKRPRLVWTPQLHKRFVDAVAHLGIKN
AVPKTIMQLMSVDGLTRENVASHLQKYRLYLKRMQGLGGGGGGGGGGGAGGSHSSGSGTD
AATEHLFATGPVPFLPPGHRAPAAADSYPPFSPMGGAHHHQHHQIGHFHHPATRPLAHYG
GAAVGGFDHGFLSRVGPPAGPPGMHHRMVGGGAGMGMMAPASFADEMDLGSRGGGGSGSR
RELTLFPTSGDH*

MREEEEPSWFARGEEQEQQLPRPDELMPLTQTLITPDLAVAFDITTHGAGGAGPVPDING
GGASSAAGSSGGGGGGGGDEPARTLKRPRLVWTPQLHKRFVDAVAQLGIKNAVPKTIMQL
MSVDGLTRENVASHLQKYRLYLKRMQGLGGGGGGGSHSSGSGSATDAATEHLFATGPVPF
LPPAHRAPAADTYPPFSPMGSGAAHHHHRAPQIGHFHHPAARPLAHYAAAAGPGFDHGFL
SRVAPPGMHHHRMASAAAGMGMGMIAPSSFADEMDRGAGGSGGGGGRRELTLFPTSGDH*

Other information
Ka divergence:0.0869433KaKs divergence:-0.185391
GC content 1 (%):75GC content 2 (%):75GC content divergence:0
Length 1 (bp):939Length 2 (bp):900Length divergence:-0.021
MFE 1 (kcal):-534.8MFE 2 (kcal):-478.21MFE divergence-0.056