Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G400961-GRMZM2G445616
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.5902152271211
Log2 mRNA fold difference:1.0397526540504
Log2 TE fold difference:-0.40700492304835
Sequences
Protein sequence

MGFHLLAFVAARGLMQAFNLSAPLSLRLPLARHLPEALAVLYGVLAAQAAWLNGALARGA
AWSHSGSRGGVDEYVRHAMLSVYD*

MGFPLLAFVAARGLMQVFNLSAPLNLRLPLARHLPEAFAVLFGVLASHAAWLSDALARGA
AWRHTGNRGGVDEYVRYAMLSISD*

Other information
Ka divergence:-0.347728KaKs divergence:-0.958267
GC content 1 (%):74GC content 2 (%):72GC content divergence:-0.014
Length 1 (bp):255Length 2 (bp):255Length divergence:0
MFE 1 (kcal):-142.5MFE 2 (kcal):-121.3MFE divergence-0.08