Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G408462-GRMZM2G411766
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.8811521333063
Log2 mRNA fold difference:1.6815036179653
Log2 TE fold difference:-0.82665098663512
Sequences
Protein sequence

MEGVPDEKCALVAELVQVLEMARHLETRMAVLQQQGGGEHQQCRALLSTMRASIDRAVHL
AVSCRAEAARPESPPSGGDGSPRSGSGGSDQAGEVRGRGNATGQCKKRKALPKSSIQVRV
STVQDVSPLDDGLSWRKYGQKDILGAKYPRAYFRCTHRHTQSCQASKQVQRTDGDPLLFD
VVYHGTHTCAQAAAAAAHHHGNNHPATDQATSPGCVVAGPAALPFSLRPAASNKPTGAAA
DDGATSSRFIATGCTVVTASPFVYPATPDCQLVSGGGGGGYAVGGGGGVAGVPNVPDVEL
ASTTNSPMAMGEMDFMFPLDAADFLELENPASYF*

MEGVPEDKCTLIAELVRVLEMARQLETYMAVQQQQGDAAGGDQRCRALVSTMRACIDRAV
SCCAEGRPDSPPSGGDGSPRSGVSDQAGGEFRGRGNAAGQCKKRKTLPKWSSQVRVSAVQ
DVSPLDDGLSWRKYGQKDILGAKYPRSYFRCTHRHTQSCQASKHVQRTDGDPLLFDVVYH
GSHTCAQAQGAAARPVNQPAQQQTDTEQTTSPGFQAGPAVLPFSLRPASNKPPGAHDAGD
GATSSRFIATGCTVTASPFVSPATSECRIVSGGYALGGGVTMAGVRNVPDVELAATTNSL
MAMGQMDFMFPLDAASFLELESPASYC*

Other information
Ka divergence:-0.0115052KaKs divergence:-0.17943
GC content 1 (%):70GC content 2 (%):67GC content divergence:-0.022
Length 1 (bp):1005Length 2 (bp):984Length divergence:-0.011
MFE 1 (kcal):-515.9MFE 2 (kcal):-470.5MFE divergence-0.046