Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G416120-GRMZM2G458208
Species:maize
Duplication type:WGD
Function (paralog1):Chaperonin CPN60-2, mitochondrial Precursor (HSP60-2)
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.79661353733055
Log2 mRNA fold difference:-0.9040014626356
Log2 TE fold difference:2.0366668748703
Sequences
Protein sequence

MYRAAASLASKARQAGSSSAARQVGSRLAWSRNYAAKDIKFGVEARALMLRGVEELADAV
KVTMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGD
GTTCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQV
GTISANGEREIGELIAKAMEKVGKEGVITIADGNTLYNELEVVEGMKLDRGYISPYFITN
SKAQKCELEDPLILIHDKKVTNMHAVVKVLEMALKKQRPLLIVAEDVESEALGTLIINKL
RAGIKVCAVKAPGFGENRKANLQDLAILTGGEVITEELGMNLENVEPHMLGSCKKVTVSK
DDTVILDGAGDKKSIEERADQIRSAVENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEA
EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELDKLQTANFDQKIGVQIIQNAL
KTPVHTIASNAGVEGAVVVGKLLEQGNTDLGYDAAKDEYVDMVKAGIIDPLKVIRTALVD
AASVSSLMTTTESIIVEIPKEEAPAPAMGGMGGMDY*

MYRAAASLASKARQAGNSLATRQVGSRLAWSRNYAAKDIKFGVEARALMLRGVEELADAV
KVTMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGD
GTTCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQV
GTISANGEREIGELIAKAMEKVGKEGVITIADGNTLYNELEVVEGMKLDRGYISPYFITN
SKTQKCELEDPLILIHDKKVTNMHAVVKVLEMALKKQKPLLIVAEDVESEALGTLIINKL
RAGIKVCAVKAPGFGENRKANLQDLAILTGGEVITEELGMNLENFEPHMLGTCKKVTVSK
VAPVILDGAGDKKSMKRDESLE

Other information
Ka divergence:0.752722KaKs divergence:0.695777
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1731Length 2 (bp):1146Length divergence:-0.203
MFE 1 (kcal):-574.4MFE 2 (kcal):-367.19MFE divergence-0.22