Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G419777-GRMZM2G450044
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100278192 (LOC100278192), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.46331564856463
Log2 mRNA fold difference:0.4376725560984
Log2 TE fold difference:0.41611518991149
Sequences
Protein sequence

MGNCLVIQQADDRKEIKIVSVVDDGGVLDTPSSSPAGARSLTKVPAAGAAALCEPLLPAA
GGAAAVRVKLVISKQELRKMLDKEGVSLDDMVSSLVRKEASGGDREQELCCGGWRPALES
IPEGSDL*

MGNCLVIQDRKEIKIMSMGGGGGEVLKMPSPPGSLSKAADDVIVDADAAAAGAAAVVRVK
LVISKQELKKMLDREGVSLDDVVSSLVLRNRELEEVCCGGWRPALESIPEGSDL*

Other information
Ka divergence:0.0222002KaKs divergence:-0.37917
GC content 1 (%):66GC content 2 (%):63GC content divergence:-0.023
Length 1 (bp):384Length 2 (bp):345Length divergence:-0.053
MFE 1 (kcal):-191MFE 2 (kcal):-153.01MFE divergence-0.11