Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G431350-GRMZM5G883149
Species:maize
Duplication type:WGD
Function (paralog1):LOC542595
Function (paralog2):hypothetical protein LOC100274110

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.38839703473948
Log2 mRNA fold difference:-0.51593552031146
Log2 TE fold difference:0.79426216080564
Sequences
Protein sequence

METCPSVKNILLLDSEGKRVAVKYYSDDWPTLSAKLAFEKSVFTKTQKANAGTEVEIVMF
DGQIVVYKFIQDLHFFVTGGEEENELILASVLQGFSDAVERLLKNMVDKRTALENLDMIL
LCLDEIVDGGIVLETEGREIAEKVSGHGLEGASSAEQTLVNALTQAREHFAKSLLM*

METFPSVKNILLLDSEGKRVAVKYYSDGWPTLSAKLAFEKSVFAKTQKANAGTDAEIVMF
DGQIVVYKFIQDLHFFVTGGEEENELILASVLQGFSDAVERLLKNMVDKRTALENLDLIL
LCLDEIVDGGIVLETEGREIAEKVSGHGSEGASSAEQTLVNALTQAREHLAKSLLM*

Other information
Ka divergence:0.00458415KaKs divergence:0.0656566
GC content 1 (%):45GC content 2 (%):48GC content divergence:0.032
Length 1 (bp):531Length 2 (bp):531Length divergence:0
MFE 1 (kcal):-151.02MFE 2 (kcal):-174.52MFE divergence0.072