Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G436199-GRMZM5G892522
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100278417
Function (paralog2):thioredoxin X

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.49725682697434
Log2 mRNA fold difference:-0.4786934504377
Log2 TE fold difference:-0.037018988920668
Sequences
Protein sequence

MSSAPSTTASTIAASIHTPFSSGPRGARLPAALRLSLAQLRSAGCRAAPGRLARPRARVR
CGAAARFIGQGEFPAEVLESELPVLVDFVADWCGPCRLIAPVVDWASEEYAGRLKIVKID
HDANPQLIEEYKVYGLPTLILFKDGQEVPGSRREGAMIKDKFKEYLEPLLTTITTAA*

MASAPSTTAPTLAPSLRTPFSSAPRGARLAAAPRLSRAQPGQAGCRAAPGRLARPRSRVR
CGAAARFIGQGEFPAEVLESELPVLVDFVADWCGPCRLIAPVVDWASEEYDGRVKIVKID
HDANPQLIEEYKVYGLPTLIFFKNGREVADSRREGAMTKDKFKQYLEPLLTTTVT*

Other information
Ka divergence:-0.0826647KaKs divergence:-0.728696
GC content 1 (%):62GC content 2 (%):65GC content divergence:0.024
Length 1 (bp):534Length 2 (bp):528Length divergence:-0.006
MFE 1 (kcal):-234MFE 2 (kcal):-242.1MFE divergence0.017