Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G443265-GRMZM2G447617
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191287
Function (paralog2):organic anion transporter

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.0106851981891
Log2 mRNA fold difference:-0.57808291222469
Log2 TE fold difference:-0.4321238516892
Sequences
Protein sequence

MTAKGGATPSPGGAGPAAGNGRLFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTM
CHMSACALLSYAAIAWLRVVPMQLVRSRVQLAKIAALSLVFCGSVVSGNVSLRYLPVSFN
QAVGATTPFFTAVFAYIMTVKRESWVTYLTLVPVVTGVIIASGGEPSFHLFGFIMCIGAT
AARALKTVLQGILLSSDGEKLNSMNLLLYMAPIAVIFLLPATIFMEDNVVGVTIELAKKD
FTIVWLLLFNSCLSYFVNLTNFLVTKHTSALTLQVLGNAKGAVAVVVSIMIFRNPVSITG
MLGYTLTVFGVILYSESKKRSNKP*

MAAKGGATPSPGGTGPAAGNGRLFTVGLVTAWYSSNIGVLLLNKYLLSNYGFKYPIFLTM
CHMSACALLSYAAIAWLRVVPMQLVRSRVQLAKIAALSLVFCGSVVSGNVSLRYLPVSFN
QAVGATTPFFTAVFAYIMTVKRESWITYLTLVPVVTGVIIASGLILWVYSIISCKKSPKE
PQLYLRLDNDLTDQDARLHIREKLNSMNLLLYMAPIAVIFLLPATIFMEDNVVGITIQLA
KKDFTIVWLLLFNSCLSYFVNLTNFLVTKHTSALTLQVLGNAKGAVAVVISIMIFRNPVS
ITGMLGYTLTVFGVILYSESKKRSNKP*

Other information
Ka divergence:0.87744KaKs divergence:0.53764
GC content 1 (%):55GC content 2 (%):53GC content divergence:-0.019
Length 1 (bp):975Length 2 (bp):984Length divergence:0.005
MFE 1 (kcal):-327.24MFE 2 (kcal):-305.29MFE divergence-0.035