Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G453320-GRMZM2G574534
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.23055165321612
Log2 mRNA fold difference:-0.47023978607436
Log2 TE fold difference:0.2609546131344
Sequences
Protein sequence

MSLTGPGPEKRQSRESARTRLREEEERVSFGLERAMVFASGSAAGGPQVLTARFVRQVVQ
GRWFMVFACLLILSASGATYIFSIYSKVLKSTLGYDQRTLNTLSFFKDLGANVGVISGLI
NEVTPPWVVLAMGAAMNLAGYLMIYLAIDGRTARPPVWLMCIYICVGANSQSFANTGALV
TCVKNFPESRGVVLGLLKGFVGLSGAIFTQLYLAIYGDDAKSLVLLIAWLPAAVTILFVH
TVRIMPYPRASRRRGPSAAATSNDAFFCFLYISIALATYLLVMIVVQKQVNFSHAAFAVS
AAALLLILFLPLAVVVKQEYKIQKELEESLREDPTVTVEKPATAASLQLVAAAAAAPEPA
VAQSMTTGTEAKRSSCLGSCLRHMFSPPAQGEDYTILQALVSVDMLVLFLATICGVGGTL
TAIDNMGQIGQSLGYPAKSINTFVSLISIWNYAGRVTAGFASEVFLARYKFPRPLMLTLV
LLLSCVGHLLIAFGVPQSLYVASVVIGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGSVA
SPIGAYVLNVRVAGALYDVEAAKQHGGSLAGGADKTCIGVQCFRKAFLIITAATVAGALV
SLVLVWRTRNFYRGDIYAKFRDSADADAAEERAEAEIGSTEVNGRKQ*

MSLTGPEPEKRQSRESARTRLRVEEERVCFGLERAMVFASGSAAGGPQVLTARFVRQVVQ
GRWFMVFACLLILSASGATYIFSIYSEVLKSTLGYDQRTLNTLCFYKDLGANVDVGVISG
LINEVTPPWVVLAMGAAMNLAGYLMIYLAIDGRTGRPPVWLMCIYICVGANSQSFANTGA
LVTCVKNFPESRGVVLGLLKGFVGLSGAIFTQLYLAIYGDDAKSLVLLIAWLPAAVTILF
VHTVRIMPYPRASRRRGPSAAATSNDAFFCFLYISIALATYLLVMIVVQKQVNFSHAAFA
VSAAALLLILFLPLAVVVKQEYKIQKELEESLREDPTVTVEKPATAASLQLVAAAAAAPE
PAVAQSMTTGTEAKRSSCLGSCLRHMFSPPAQGEDYTILQALVSVDMLVLFLATICGVGG
TLTAIDNMGQIGQSLGYPAKSINTFVSLISIWNYAGRVTAGFASEVFLARYKFPRPLMLT
LVLLLSCVGHLLIAFGVPQSLYVASVVIGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGS
VASPIGAYVLNVRVAGALYDVEAAKQHGGSLAGGADKTCIGVQCFRKAFLIITAATVAGA
LVSLVLVWRTRNFYRGDIYAKFRDSADADAAEERAEAEIGSTEVNGRKQ*

Other information
Ka divergence:1KaKs divergence:0.999241
GC content 1 (%):66GC content 2 (%):66GC content divergence:0
Length 1 (bp):1944Length 2 (bp):1950Length divergence:0.002
MFE 1 (kcal):-920.42MFE 2 (kcal):-920.13MFE divergence0