Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G542994-GRMZM5G878754
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279432
Function (paralog2):protein mago nashi

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.8371994849762
Log2 mRNA fold difference:1.6160656614599
Log2 TE fold difference:-0.86383714382706
Sequences
Protein sequence

MAAAAAGGENSGAGAGAGEGEFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKND
TMIRKEVFVSPSVLREARRIIQESDIMKEDDSNWPEPDRIGRQELEIVMGNEHISFTTSK
IGSLVDVQSSKDPEGLRIFYYLVQDLKCFVFSLINLHFKIKPIQS*

MAAAGGENSGAGEGEGEFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIR
KEVFVSPSVLREARRIIQESDIMKEDDSNWPEPDRIGRQELEIVMGNEHISFTTSKIGSL
VDVQSSKDPEGLRIFYYLVQDLKCFVFSLINLHFKIKPIQS*

Other information
Ka divergence:-0.00547303KaKs divergence:-0.674877
GC content 1 (%):60GC content 2 (%):60GC content divergence:0
Length 1 (bp):498Length 2 (bp):486Length divergence:-0.012
MFE 1 (kcal):-184.94MFE 2 (kcal):-180MFE divergence-0.014