Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G701193-GRMZM5G874500
Species:maize
Duplication type:WGD
Function (paralog1):LOC100280495
Function (paralog2):hypothetical protein LOC100193566

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.9419079546067
Log2 mRNA fold difference:1.3182490680037
Log2 TE fold difference:0.62710370299901
Sequences
Protein sequence

MTEAQSPLSATMAKEAQSSPSATVAQATALPQLVLFNSLTKREEPFQPRVEGKVGMYVCG
VTPYDFSHIGHARAYVAFDVLYRYLKFLGYEVEYVRNFTDIDDKIIKRANERGETVTSLS
SRFINEFLLDMTELQCLPPTCEPRVTEHIEHIIELITKIMENDKAYAMEGDVYFSVESFP
EYLSLSGRKFDQNQAGARVAFDTRKRNPADFALWKAAKEGEPFWDSPWGRGRPGWHIECS
AMSAHYLGHLFDIHGGGKDLIFPHHENELAQSRAAYPESEVKCWMHNGFVNKDDKKMAKS
DNNFFTIRDLSLEVITVVFVQITALYHPLALRFFLMRTHYRSDVNHSDQALEIASDRVYY
IFQTLYDCEEVLATYREEGISLSVPFEEQNLIDKHHSEFLKYMSNDLKTTDVLDRCFMEL
LKAINSSLNDLKKLQQKIEQQKKKQQQQKKQQQKQQQLQKQPEHYIQALIALEIELKNKL
SILGLMPSSSLAEVLKQLKDKALKRAGLTEEKLQEQIEQRNVARKNKQFEISDGIRKNLA
TKGIALMDEPSGTVWRPCEPEGPHPLNK*

MAEEVQAPLSATMAKEAQSPPSATIAEATAPPQLLLFNSFTKREEPFQPRVEGKVGMYVC
GVTPYDFSHIGHARAYVAFDVLYRYLKFLGYEVEYVRNFTDIDDKIIKRANERGETVTSL
SSQFINEFLLDMTELQCLPPTCEPRVTEHIEHIIKLITQIMENGKAYAIEGDVYFSVESF
PEYLSLSGRKFDQNQAGARVAFDTRKRNPADFALWKAAKEGEPFWDSPWGRGRPGWHIEC
SAMSAHYLGHVFDIHGGGKDLIFPHHENELAQSRAAYPDSEVKCWMHNGFVNKDDKKMAK
SDNNFFTIRDIIALYHPMALRFFLMRTHYRSDVNHSDQALEIASDRVYYIYQTLYDCEEV
LATYREEGTSLPVPSEEQNLIGKHHSEFLKHMSNDLKTTDVLDRCFMELLKAINSSLNDL
KKLQQKIEQQKKKQQQQKKQQQQKQQQQKQQQLQKQPEDYIQALIALETELKNKLSILGL
MPSSSLAEVLKQLKDKSLKRAGLTEEQLQEQIEQRNVARKNKQFEISDGIRKNLATKGIA
LMDEPSGTVWRPCEPERSEES*

Other information
Ka divergence:-0.461769KaKs divergence:-0.0307087
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1707Length 2 (bp):1686Length divergence:-0.006
MFE 1 (kcal):-543.47MFE 2 (kcal):-536.54MFE divergence-0.006