Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM5G806839-GRMZM5G889719
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):DREB-like protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.15740278627858
Log2 mRNA fold difference:-0.5213226717004
Log2 TE fold difference:0.90621069016409
Sequences
Protein sequence

MAQELQETSSSSATTTTSSCTTSCCSSTVTDSSSSPPSPAAANAAPAPRKAEAETGGDED
GCAGKAAPAKKRERSSEGKHPTYRGVRMRAWGKWVSEIREPRKKSRIWLGTFPTAEMAAR
AHDAAALAIKGRATQLNFPVLAGVLPRAASAAPKDVQAAAMLAAAFTSPSSAPSELDAGA
PAPREVPATKNGSPSEDEAGAEAPVPPAAASQPGTPSSGVDEERQLFDLPDLLLDVRDGF
GRFPPMWAPFHDVLEVNAEEEPLLWE*

MAQELHETSSCSATTTSSCTTSCCSSTVTDSSSSPPSPAAANAAPATRKRQALEAEAEAE
AGGEEEEEEEEGCAGNKAAPAKKRPRGSEGKHPTFRGVRMRAWGKWVSEIREPRKKSRIW
LGTFPTAEMAARAHDVAALAIKGRAAHLNFPDLAGALPRAASAAPKDVQAAAALAAAFTS
PSSEPGAGAHEEPAAKDGAAPEEAAADAQAPVPVALPPPAASRPGTPSSGVEDERQLFDL
PDLLLDIRDGFGRFPPMWAPLTDVEEVVNAELRLEEPLLWE*

Other information
Ka divergence:-0.153425KaKs divergence:0.207795
GC content 1 (%):71GC content 2 (%):72GC content divergence:0.007
Length 1 (bp):801Length 2 (bp):846Length divergence:0.027
MFE 1 (kcal):-417.8MFE 2 (kcal):-458.1MFE divergence0.046