Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM5G807260-GRMZM5G896604
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277630
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:2.1537739297159
Log2 mRNA fold difference:3.2469582859695
Log2 TE fold difference:-1.0814505915104
Sequences
Protein sequence

MAAADYGRAYLPYAAAAPAGEYDRPCRNEVVPYGDRRLDTVVKPPAGSPAPPLPVSTRSG
GRGVGSAWCFSDPEMRRRRRVASYKAYSVEGKVKASFRRGFRWIKAKCSELIHG

MAAAADYDRAHRPYAAPAPAGEYDRPYRNEVVPYGDRRIDIIVKPPARSPPPVSNRGGGG
GVGSAWCFSDPEMKRRRRVASYKAYSAEGKVKASFRRGFRWIKAKCSELIHGWYGSRLLL
LLLLLLLLPLSPFIGVSVLLLDIFGHNGDGCFGSQASDLSFRWVMGLCTTSTDVLIFIVL
FVWIIGTTEC*

Other information
Ka divergence:-0.127723KaKs divergence:-0.592532
GC content 1 (%):71GC content 2 (%):60GC content divergence:-0.084
Length 1 (bp):342Length 2 (bp):573Length divergence:0.252
MFE 1 (kcal):-168.2MFE 2 (kcal):-225.5MFE divergence0.146