Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM5G825524-GRMZM5G844195
Species:maize
Duplication type:WGD
Function (paralog1):vacuolar protein sorting 35
Function (paralog2):hypothetical protein LOC100279276

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.83361094128258
Log2 mRNA fold difference:1.6106803080471
Log2 TE fold difference:-0.75400470866136
Sequences
Protein sequence

MASASTAVRMLPDGGADDEERWLAEGIAGVQQNAFYMHRALDSNNLKDALKYSAQMLSEL
RTSRLSPHKYYELYMRAFDEMKKLEMFFREETRRGSCSVVDMYELVQHAGNVLPRLYLLC
TVGSVYIKSKEAPAKDVLKDLVEMCRGIQHPLRGLFLRSYLSQISRDKLPDIGSEYEGDA
ETINDAVEFVLQNFIEMNKLWVRMQHLGPAREKEKRGKERNELRDLVGKNLHVLSQIEGV
DLDMYKETVLPRILEQVVNCKDDLAQFYLMDCIIQVFPDEYHLQTLETLLNAFPQLQPSV
DIKTVLSQLMDRLSNYAASSPEVLPEFLQVEAFAKFSNAIGKVIEAQPDMPVVGAVTLYV
SLLTFTLRVHPDRLDYVDQVLGACVKKLSGKAKLEDSRATKQIVALLSAPLEKYSNIVTA
LELSNYPRVMDYLDNATTKVMAVVIIQSIMKNTTCISTSDKIEALFDLIKGLIKDMDGAQ
DDELDEEDFKEEQNSVARLIHMLHNDEPEEMLKILCTVQKHILQGGPKRLTFTVPSLVFS
ALKLVRRLQSQDGDVTGEDVPATPKKIFQILHQTIDALSCVPSPELALRLYLHCAEAAND
CDLEPVAYEFFTQAFILYEEEIADSKAQITAIHLIIGTLQRMNIFGVENRDTLTHKTTGY
SAKLLKKPDQCRAVYACSHLFWADDQDGIMDGERVLLCLKRALRIANAAQQMASATRGSS
GSVTLFIEILNKYLYFFEKGIPQITNTVIQDLIELIRTEKQSDNSVADPSTEAFFSSTLR
YIEFQKQKGGSIGEKYEQIKTSS*

MAAASTSVRVLPDGGADDEERWLAEGIAGVQQNAFYMHRALDSNNLKDALKYSAQMLSEL
RTSRLSPHKYYELYMRAFDEMKKLEMFFREETRRGSCSVVDLYELVQHAGNVLPRLYLLC
TVGSVYIKSKEAPAKDVLKDLVEMCRGIQHPLRGLFLRSYLSQISRDKLPDIGSEYEGDV
ENINDAVEFVLQNFIEMNKLWVRMQHQGPAREKEKRGKERNELRDLVGKNLHVLGQIDGV
DLDMYKETVLPRILEQVVNCKDDLAQFYLMDCIIQVFPDEYHLQTLETLLSAFPQLQPSV
DIKTVLSQLMDRLSNYAASSPELLPEFLQVEAFAKFSNAIGKVIEAQPDMPVVGAITLYV
SLLTFTLRVHPDRLDYVDQVLGACVKKLSGKAKLEDSRATKQIVALLSAPLEKYSNIVTA
LELSNYPRVMDYLDNATTKVMAVVIIQSIMKNTTCISTSDKIEALFDLIKGLIKDMDGAQ
DDELDEEDFKEEQNSVARLIHMLHNDDPEEMLKILCTVQKHILQGGPKRLTFTVPSLVFS
SLKLVRRLQGQDGDVTGEDVPATPKKIFQILHQTIEALSCVPSPELALRLYLQCAEAAND
CDLEPVAYEFFTQAFILYEEEITDSKAQITAIHLIIGTLQRMNIFGVENRDTLTHKTTGY
SAKLLKKPDQCRAVYACSHLFWTDDQDGIMDGERVLLCLKRALRIANAAQQMASATRGSS
GSVTLFIEILNKYLYFFEKGIPQITNTVIQDLIELIRTEKQSDNSVADPSTEAFFSSTLR
YIEFQKQKGGTIGEKYEQIKTSS*

Other information
Ka divergence:0.0510204KaKs divergence:0.0732759
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):2412Length 2 (bp):2412Length divergence:0
MFE 1 (kcal):-745.99MFE 2 (kcal):-746.72MFE divergence0