Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM5G832805-GRMZM5G896260
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100279554 (LOC100279554), mRNA
Function (paralog2):indole-3-acetate beta-glucosyltransferase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.22297417137948
Log2 mRNA fold difference:-0.15943299506655
Log2 TE fold difference:-0.046302077621622
Sequences
Protein sequence

MAGEEHQQHSSHYGHHFLVVAYGMQGHVNPARALAHRLAKLSDVVGGCPILATLSVHVAA
HRRMFPAQLDPDAAGEEDEEEASDGVISYVPHSDSFDDGSLPRTPEDWARRRRASRESLS
AMLARFAGGGRPVTCVVCTLLVPAAVDAATRHGVPFAVYWIQPATVLAAAYHYFHGYGET
VAAADPAHEVSLPGLRRPLRVRDFPSYLVDTTGSPLARSVVGMFRELFESVDRWRPKVLV
NTFDELEAGVLSEMKRHLDVFAVGPMVAGAGGGSGSSGASNDEGRIHLYRHDDADRKRYM
EWLGAQPESSVVYVSFGSIATHTLQQMEEVVQGLLQAGRPYLLAARSWHGLEDDGARRVL
DNAAQSSGGRGTVVDWCDQPEVLAHPAVGCFVSHCGWNSTLEAVAAGVPLVGVPSLFDQP
TNTYLVVEEWGVGVRGERDGEGVLAATELARCVELVMGQGTKATAIRERVKALREMAQQA
ARAGGPAERNLEDFVNSVGDSFRPVGISVAEKTDESRTCSSE*

MVSPPALDVAREHAIPLAVFWLQPATVLALCYHYFHGHGASVAAHAADPAHEVRVPGLRR
PLRMRCLPSFLTDTSGSDRATALTDVFRELFEFLDRWRPTVLVNTFDELEPDALAEVRRH
LDVVAVGPMVGPATDARIHLFDHDDDAGKKRYTEWLHAHPDGSVVYASFGSVTKLAKRQM
QEIAGGLRQCGRPYLLVVRRDGVDDDEGGIHGLENDTEMQGMVVDWCDQLEVLSHPAVGC
FVSHCGWNSATEAMASGVPIVGVPNMFDQPTNMYLVEEEWGVGVRGERDADGVLTGAELA
RCIELVMGDGAGAVAIRERAKALQETAQAAASAAGGPAETNLCHLVKTMSK*

Other information
Ka divergence:-0.196857KaKs divergence:-0.257378
GC content 1 (%):67GC content 2 (%):68GC content divergence:0.007
Length 1 (bp):1569Length 2 (bp):1056Length divergence:-0.195
MFE 1 (kcal):-779.11MFE 2 (kcal):-523.9MFE divergence-0.196