Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM5G838496-GRMZM5G843446
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.74629258310381
Log2 mRNA fold difference:-0.33080622025618
Log2 TE fold difference:1.0990024892877
Sequences
Protein sequence

MEPLRQGRGNRARLQTILSGKDGLVAAPPPERRRPGPGRRRQRRRGRSMSELEFEEVKGL
QDLGFTFADAEVDAELASIVPGLRRKRSEEDNNSRATAASTSSARPEAADDASVAAVVAP
RRPYLSEAWDSEEEEEVRRALRSWRIPPAGDGNELKEHLRMWAHTVASAVR*

MKRPQPQQAAAEQIMALYDACWFRRLVLLASPPPAAAPRPSVPAQQAPVERDELGTTHTP
HAQRPASSSPTAGGLRHRRTRSDEATAAAFLGMEPLRLPDRGNRARLQTILSGKDGLVAA
PPPERRRPGPGRRRQRRRGRSMSELEFEEVKGLQDLGFTFADAEVDAELASIVPGLRRKR
SEEDNNSRATAASTSSARPEAADDASVAAVVAPRRPYLSEAWDSEEEEEVRRALRSWRIP
PAGDGNELKEHLRMWAHTVASAVR*

Other information
Ka divergence:-1KaKs divergence:0.847809
GC content 1 (%):72GC content 2 (%):72GC content divergence:0
Length 1 (bp):516Length 2 (bp):795Length divergence:0.213
MFE 1 (kcal):-279.81MFE 2 (kcal):-435.51MFE divergence0.218